Structure of PDB 7buz Chain B

Receptor sequence

>7buzB (length=433) Species: 4543 (Cenchrus americanus)

SEKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALS
KGYLFPQNAARLPGFHVCVGSGGERQLPEWYSEKGIELILSTEIVKADLS
TKTLTSAAGATFTYEILIIATGSSVIKLTDFGTQGADSNNILYLREIDDA
DKLVAAIQAKKGGKAVVVGGGYIGLELSAALKINDFDVTMVFPEPWCMPR
LFTADIAAFYEAYYTNKGVKVLKGTLAVGFDANANGDVTAVKLKDGKVLE
ADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAIGDVATF
PLKMYNELRRVEHVDHSRKSAEQAVKAIKGKESGESVPEYDYLPYFYSRS
FDLGWQFYGDNVGETILFGDSDPTSSKPKFGSYWIKDGKVFGAFLEGGSP
DENNAIAKVAKTQPPVASIEELKKEGLQFASKI

3D structure

• PDB: 7buz Crystal structure of Pennisetum glaucum monodehydroascorbate reductase
• Chain: B
• Resolution: 2.288 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	G13 G14 G15 V16 A17 S39 K40 E41 R48 P49 K53 I96 A122 T123 G124 R147 E148 Y174 I175 L265 G297 D298 H315 V316 S319 F348 Y349	G11 G12 G13 V14 A15 S37 K38 E39 R46 P47 K51 I94 A120 T121 G122 R145 E146 Y172 I173 L263 G295 D296 H313 V314 S317 F346 Y347
BS02	NAD	B	V170 G171 G172 Y174 I175 P195 E196 M200 L203 L228 A229 G259 V260 E314 H315 F348	V168 G169 G170 Y172 I173 P193 E194 M198 L201 L226 A227 G257 V258 E312 H313 F346

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 08:31:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7buz', asym_id = 'B', title = 'Crystal structure of Pennisetum glaucum monodehydroascorbate reductase'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7buz', asym_id='B', title='Crystal structure of Pennisetum glaucum monodehydroascorbate reductase')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '7buz', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='7buz', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>