Structure of PDB 7bib Chain B

Receptor sequence

>7bibB (length=217) Species: 9606 (Homo sapiens)

KPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQ
QVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLG
EMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKL
SRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSP
RKPPMDEKSLEEARKIF

3D structure

• PDB: 7bib Role of human salivary enzymes in bitter taste perception.
• Chain: B
• Resolution: 2.03 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  2.5.1.18: glutathione transferase.
  5.3.3.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TZ8	B	D101 R131	D98 R128
BS02	TZ8	B	Y9 R15 R45 Q54 V55 Q67 T68 R217 F220	Y6 R12 R42 Q51 V52 Q64 T65 R214 F217

Gene Ontology

Molecular Function

• GO:0004364 glutathione transferase activity
• GO:0004601 peroxidase activity
• GO:0004602 glutathione peroxidase activity
• GO:0004769 steroid delta-isomerase activity
• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0006693 prostaglandin metabolic process
• GO:0006749 glutathione metabolic process
• GO:0006805 xenobiotic metabolic process
• GO:0030855 epithelial cell differentiation
• GO:0043651 linoleic acid metabolic process
• GO:0098869 cellular oxidant detoxification
• GO:1901687 glutathione derivative biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7bib, PDBe:7bib, PDBj:7bib
• PDBsum: 7bib
• PubMed: 35344726
• UniProt: P08263|GSTA1_HUMAN Glutathione S-transferase A1 (Gene Name=GSTA1)