Structure of PDB 7ax1 Chain B

Receptor sequence
>7ax1B (length=253) Species: 9606 (Homo sapiens) [Search protein sequence]
QRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNAD
YQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYA
QDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSG
YDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGL
QEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHL
YGL
3D structure
PDB7ax1 Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
ChainB
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.13.4: poly(A)-specific ribonuclease.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MG B D40 E42 D31 E33
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0004527 exonuclease activity
GO:0004532 RNA exonuclease activity
GO:0004535 poly(A)-specific ribonuclease activity
GO:0005515 protein binding
GO:0034584 piRNA binding
GO:0046872 metal ion binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0010629 negative regulation of gene expression
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0033962 P-body assembly
GO:0035279 miRNA-mediated gene silencing by mRNA destabilization
GO:0042509 regulation of tyrosine phosphorylation of STAT protein
GO:0045070 positive regulation of viral genome replication
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051607 defense response to virus
GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0060339 negative regulation of type I interferon-mediated signaling pathway
GO:0061014 positive regulation of mRNA catabolic process
GO:0140991 piRNA-mediated gene silencing by mRNA destabilization
GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016604 nuclear body
GO:0016607 nuclear speck
GO:0030014 CCR4-NOT complex
GO:0030015 CCR4-NOT core complex
GO:0043232 intracellular non-membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ax1, PDBe:7ax1, PDBj:7ax1
PDBsum7ax1
PubMed34038562
UniProtQ9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subunit 7 (Gene Name=CNOT7)

[Back to BioLiP]