Structure of PDB 7aaw Chain B

Receptor sequence

>7aawB (length=311) Species: 226900 (Bacillus cereus ATCC 14579)

EKIYDVVIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENY
PGYESILGPDLSNKMFEHAKKFGAEYAYGDVKEVIDGKEYKTIIAGKKEY
KARAIIVASGAEYKKIGVPGETELGGRGVSYCAVCDGAFFKGKELIVIGG
GDSAVEEGVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHT
IKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPFVELGI
TNENGYLETNERMETKIPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQH
YVEELLEELKT

3D structure

• PDB: 7aaw Thioredoxin reductase from Bacillus cereus exhibits distinct reduction and NADPH-binding properties.
• Chain: B
• Resolution: 2.25 Å

Enzymatic activity

• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	B	E54 A144 F145	E48 A138 F139
BS02	FAD	B	G16 G18 P19 A20 E39 R40 G45 Q46 T50 N55 G85 D86 V87 S115 G116 Y119 C141 G280 D281 Q289 I290	G10 G12 P13 A14 E33 R34 G39 Q40 T44 N49 G79 D80 V81 S109 G110 Y113 C135 G274 D275 Q283 I284
BS03	NAP	B	G156 G157 D158 S159 E162 H178 R179 R180 R184 I242	G150 G151 D152 S153 E156 H172 R173 R174 R178 I236
BS04	GLC	B	D52 G132 G134 D142 F145 F146	D46 G126 G128 D136 F139 F140

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7aaw, PDBe:7aaw, PDBj:7aaw
• PDBsum: 7aaw
• PubMed: 34492167
• UniProt: Q815J1