Structure of PDB 7a6y Chain B

Receptor sequence
>7a6yB (length=217) Species: 9606 (Homo sapiens) [Search protein sequence]
DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNV
VGARRSSWRVISSIEQKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKN
CSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS
KEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTK
DSTLIMQLLRDNLTLWT
3D structure
PDB7a6y 14-3-3 proteins inactivate DAPK2 by promoting its dimerization and protecting key regulatory phosphosites.
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B R57 K125 R132 Y133 N178 V181 E185 N229 L232 W233 R55 K114 R121 Y122 N167 V170 E174 N212 L215 W216
BS02 FSC B D218 L221 D201 L204
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005080 protein kinase C binding
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0008426 protein kinase C inhibitor activity
GO:0019904 protein domain specific binding
GO:0030971 receptor tyrosine kinase binding
GO:0042802 identical protein binding
GO:0140031 phosphorylation-dependent protein binding
GO:0140311 protein sequestering activity
Biological Process
GO:0002842 positive regulation of T cell mediated immune response to tumor cell
GO:0006469 negative regulation of protein kinase activity
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0009966 regulation of signal transduction
GO:0022409 positive regulation of cell-cell adhesion
GO:0032869 cellular response to insulin stimulus
GO:0032880 regulation of protein localization
GO:0042149 cellular response to glucose starvation
GO:0045664 regulation of neuron differentiation
GO:0048167 regulation of synaptic plasticity
GO:0050870 positive regulation of T cell activation
GO:1904262 negative regulation of TORC1 signaling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0031982 vesicle
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a6y, PDBe:7a6y, PDBj:7a6y
PDBsum7a6y
PubMed34413451
UniProtP61981|1433G_HUMAN 14-3-3 protein gamma (Gene Name=YWHAG)

[Back to BioLiP]