Structure of PDB 6zxa Chain B

Receptor sequence
>6zxaB (length=44) Species: 765910 (Marichromatium purpuratum 984) [Search protein sequence]
AANLSGLTDAQAKEFHEHWKHGVWSWVMIASAVHVVTWIYQPWF
3D structure
PDB6zxa The 2.4 angstrom cryo-EM structure of a heptameric light-harvesting 2 complex reveals two carotenoid energy transfer pathways.
ChainB
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL B H20 W23 K24 V27 H16 W19 K20 V23
BS02 BCL B W30 I33 A34 V37 H38 W26 I29 A30 V33 H34
BS03 BCL B W30 A34 H38 V39 W47 W26 A30 H34 V35 W43
BS04 QS2 B W28 S29 M32 I33 W24 S25 M28 I29
BS05 QSE B F19 H22 W23 G26 V27 W30 F15 H18 W19 G22 V23 W26
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zxa, PDBe:6zxa, PDBj:6zxa
PDBsum6zxa
PubMed33579696
UniProtW0E5B0

[Back to BioLiP]