Structure of PDB 6zrn Chain B

Receptor sequence
>6zrnB (length=173) Species: 9606 (Homo sapiens) [Search protein sequence]
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGLEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQ
ILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAK
TRANVDKVFFDLMREIRTKKMSE
3D structure
PDB6zrn Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
ChainB
Resolution1.482 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GNP B G24 V25 G26 K27 S28 A29 F39 E41 D42 Y43 P45 T46 G71 N128 K129 D131 L132 S158 A159 K160 G14 V15 G16 K17 S18 A19 F29 E31 D32 Y33 P35 T36 G61 N118 K119 D121 L122 S148 A149 K150
BS02 MG B S28 T46 S18 T36
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0031625 ubiquitin protein ligase binding
GO:0051117 ATPase binding
Biological Process
GO:0001928 regulation of exocyst assembly
GO:0001934 positive regulation of protein phosphorylation
GO:0006915 apoptotic process
GO:0007165 signal transduction
GO:0007265 Ras protein signal transduction
GO:0009267 cellular response to starvation
GO:0031623 receptor internalization
GO:0032091 negative regulation of protein binding
GO:0032092 positive regulation of protein binding
GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
GO:0051301 cell division
GO:0060178 regulation of exocyst localization
GO:0071360 cellular response to exogenous dsRNA
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:2000786 positive regulation of autophagosome assembly
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030496 midbody
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6zrn, PDBe:6zrn, PDBj:6zrn
PDBsum6zrn
PubMed33214225
UniProtP11234|RALB_HUMAN Ras-related protein Ral-B (Gene Name=RALB)

[Back to BioLiP]