Structure of PDB 6zqt Chain B

Receptor sequence
>6zqtB (length=171) Species: 9606 (Homo sapiens) [Search protein sequence]
ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEV
QIDILDTAGLEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQIL
RVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTR
ANVDKVFFDLMREIRTKKMSE
3D structure
PDB6zqt Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
ChainB
Resolution1.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP B G24 V25 G26 K27 S28 A29 F39 E41 Y43 T46 G71 N128 K129 D131 L132 S158 A159 G12 V13 G14 K15 S16 A17 F27 E29 Y31 T34 G59 N116 K117 D119 L120 S146 A147
BS02 MG B S28 T46 S16 T34
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0031625 ubiquitin protein ligase binding
GO:0051117 ATPase binding
Biological Process
GO:0001928 regulation of exocyst assembly
GO:0001934 positive regulation of protein phosphorylation
GO:0006915 apoptotic process
GO:0007165 signal transduction
GO:0007265 Ras protein signal transduction
GO:0009267 cellular response to starvation
GO:0031623 receptor internalization
GO:0032091 negative regulation of protein binding
GO:0032092 positive regulation of protein binding
GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
GO:0051301 cell division
GO:0060178 regulation of exocyst localization
GO:0071360 cellular response to exogenous dsRNA
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:2000786 positive regulation of autophagosome assembly
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030496 midbody
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zqt, PDBe:6zqt, PDBj:6zqt
PDBsum6zqt
PubMed33214225
UniProtP11234|RALB_HUMAN Ras-related protein Ral-B (Gene Name=RALB)

[Back to BioLiP]