Structure of PDB 6ziz Chain B

Receptor sequence

>6zizB (length=169) Species: 9606 (Homo sapiens)

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGREEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQI
KRVKDSDDVPMVLVGNKSDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQ
GVEDAFYTLVREIRQYRMK

3D structure

• PDB: 6ziz Drugging all RAS isoforms with one pocket.
• Chain: B
• Resolution: 1.785 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	B	G13 V14 G15 K16 S17 A18 F28 V29 D30 Y32 T35 G60 N116 K117 D119 S145 A146	G13 V14 G15 K16 S17 A18 F28 V29 D30 Y32 T35 G60 N116 K117 D119 S145 A146
BS02	MG	B	S17 T35	S17 T35
BS03	EZZ	B	K5 V7 E37 D54 L56 Y71 T74 G75	K5 V7 E37 D54 L56 Y71 T74 G75

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0003925 G protein activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0019003 GDP binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0000165 MAPK cascade
• GO:0001938 positive regulation of endothelial cell proliferation
• GO:0007165 signal transduction
• GO:0007265 Ras protein signal transduction
• GO:0045445 myoblast differentiation

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005789 endoplasmic reticulum membrane
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0070062 extracellular exosome
• GO:0070821 tertiary granule membrane

External links

• PDB: RCSB:6ziz, PDBe:6ziz, PDBj:6ziz
• PDBsum: 6ziz
• PubMed: 32779487
• UniProt: P01111|RASN_HUMAN GTPase NRas (Gene Name=NRAS)