Structure of PDB 6zif Chain B

Receptor sequence

>6zifB (length=107) Species: 622637 (Methylocystis sp. ATCC 49242) [Search protein sequence]

SKEMQSCVDECLRCYQMCFGMAMTHCLETGGDHVKPKHFRAMISCAEMCR
NAAHMMLMKSPQARHICEDCAEACEACAKECDALPDMKDCAAQCRRCAEA
CRKMAGQ

3D structure

PDB

6zif The importance of sites at the entrance of a copper storage protein for Cu(I) binding and removal

Chain

Resolution

2.2 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	B	H69 D73	H65 D69
BS02	CU1	B	C11 M60 C71 M108	C7 M56 C67 M104
BS03	CU1	B	C11 C15	C7 C11
BS04	CU1	B	C71 C105	C67 C101
BS05	CU1	B	C101 C105	C97 C101
BS06	CU1	B	C53 C101	C49 C97
BS07	CU1	B	C74 C78	C70 C74
BS08	CU1	B	C18 C78	C14 C74
BS09	CU1	B	C49 C53	C45 C49
BS10	CU1	B	C18 C22	C14 C18
BS11	CU1	B	C94 C98	C90 C94
BS12	CU1	B	M46 C85 C94	M42 C81 C90
BS13	CU1	B	C81 C85	C77 C81
BS14	CU1	B	C30 H42	C26 H38
BS15	CU1	B	C30 H37 M91	C26 H33 M87

External links