Structure of PDB 6zi3 Chain B

Receptor sequence

>6zi3B (length=403) Species: 1890 (Streptomyces antibioticus)

HTGPTPADAVPAYPFSLPHALDLDPHYAELRRDEPVSRVRLPYGEGTAWL
VTRMSDARIVLGDSRFSTAAATDPATPRMFPTPPEPDGVLAQDPPDHTRL
RRLVGKAFTARRVEEMRPRVRSLVDSLLDDMVAHGSPADLVEFLAVPFPV
AVICELLGVPLEDRDLFRTFSDAMLSSTRLTAAEIQRVQQDFMVYMDGLV
AQRRDAPTEDLLGALALATDNDDHLTKGEIVNMGVSLLIAGHETSVNQIT
NLVHLLLTERKRYESLVADPALVPAAVEEMLRYTPLVSAGSFVRVATEDV
ELSTVTVRAGEPCVVHFASANRDEEVFDHADELDFHRERNPHIAFGHGAH
HCIGAQLGRLELQEALSALVRRFPTLDLAEPVAGLKWKQGMLIRGLERQI
VSW

3D structure

• PDB: 6zi3 Dissecting the Cytochrome P450 OleP Substrate Specificity: Evidence for a Preferential Substrate.
• Chain: B
• Resolution: 2.08 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S180 A244 E247 T248 S249 S292 C356 I357 G358 E365 I397
• Catalytic site (residue number reindexed from 1): S176 A240 E243 T244 S245 S288 C352 I353 G354 E361 I393

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	V93 L94 H101 R105 A244 G245 T248 L290 R298 A348 F349 H354 C356 I357 G358	V89 L90 H97 R101 A240 G241 T244 L286 R294 A344 F345 H350 C352 I353 G354
BS02	DEB	B	F84 L94 L396	F80 L90 L392
BS03	RAM	B	E89 M178 Q193 N236 V239 S240	E85 M174 Q189 N232 V235 S236

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:6zi3, PDBe:6zi3, PDBj:6zi3
• PDBsum: 6zi3
• PubMed: 33036250
• UniProt: Q59819