Structure of PDB 6yws Chain B

Receptor sequence

>6ywsB (length=326) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]

IVTPYVRDAGMMRTYKPHTPGIRHLKRPINDHLWKGRPYLPLTFPKKGQS
KGGRNHSGRVTVRHRGGGHKRRIRMVDFERWIPGPHTVLRIEYDPGRSAH
IALVKEEATGRKSYIVAADGMRAGDVVQSYRSGLPQDLLDSMGGVVDPGI
LAARTCWRGNCLPVSMIPVGTQIYCVGSRPDGKAVFCRSAGTYATIISKE
EETREDGTKVMTGKFVNVRLQSGEIRRVSKDACATVGIASNIMHHYRQLG
KAGRSRWLNIRPTVRGLAMNANDHPHGGGRGKSKGNRHPVSPWGTPAKGG
YKTRRKSNVNKWVVTPRVRNMGVRRN

3D structure

PDB

6yws Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.

Chain

Resolution

2.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	Y58 R60 K69 P70 H71 T72 P73 G74 R76 H77 R80 W87 K88 G89 R90 Y92 L93 P94 P98 K99 K100 G101 Q102 K104 G105 R107 N108 H109 S110 G111 R112 V113 T114 V115 R116 R118 G119 G120 H122 K123 R124 R125 I126 R127 R143 Y146 P148 R150 K165 S231 R232 V238 F239 C240 R241 S242 A243 G244 T245 L273 Q274 S275 E277 R279 I295 H297 H298 Q301 L302 G303 K304 A305 G306 R307 S308 R309 W310 R314 P315 T316 V317 R318 G319 L320 A321 M322 N323 A324 N325 D326 H327 H329 G332 R333 G334 K335 K337 G338 N339 R340 H341 P342 S344 P345 W346 A350 K351 G352 G353 Y354 K355 T356 R357 R358 S360 N363 W365 R370 R372 N373 M374 G375 R377 R378	Y5 R7 K16 P17 H18 T19 P20 G21 R23 H24 R27 W34 K35 G36 R37 Y39 L40 P41 P45 K46 K47 G48 Q49 K51 G52 R54 N55 H56 S57 G58 R59 V60 T61 V62 R63 R65 G66 G67 H69 K70 R71 R72 I73 R74 R90 Y93 P95 R97 K112 S178 R179 V185 F186 C187 R188 S189 A190 G191 T192 L220 Q221 S222 E224 R226 I242 H244 H245 Q248 L249 G250 K251 A252 G253 R254 S255 R256 W257 R261 P262 T263 V264 R265 G266 L267 A268 M269 N270 A271 N272 D273 H274 H276 G279 R280 G281 K282 K284 G285 N286 R287 H288 P289 S291 P292 W293 A297 K298 G299 G300 Y301 K302 T303 R304 R305 S307 N310 W312 R317 R319 N320 M321 G322 R324 R325

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6yws, PDBe:6yws, PDBj:6yws
PDBsum	6yws
PubMed	33056988
UniProt	Q7SCX7\|RML2_NEUCR Large ribosomal subunit protein uL2m (Gene Name=rml2)

[Back to BioLiP]