Structure of PDB 6yw6 Chain B

Receptor sequence

>6yw6B (length=277) Species: 9606 (Homo sapiens) [Search protein sequence]

VVCDNGTGFVKCGYAGSNFPEHIFPAIDDMKHLWDYTFGPIQAVLTLYAQ
GLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLL
RGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDG
RIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK
HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
RKHMVFLGGAVLADIMKDKDNFWMTRQ

3D structure

PDB

6yw6 Cryo-EM of human Arp2/3 complexes provides structural insights into actin nucleation modulation by ARPC5 isoforms.

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	G16 F17 G160 D161 K217 E218 G305 G306 S307 M309	G8 F9 G61 D62 K118 E119 G206 G207 S208 M210

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0005200	structural constituent of cytoskeleton
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0051015	actin filament binding

	Biological Process
GO:0007163	establishment or maintenance of cell polarity
GO:0008356	asymmetric cell division
GO:0010592	positive regulation of lamellipodium assembly
GO:0016344	meiotic chromosome movement towards spindle pole
GO:0016482	cytosolic transport
GO:0030036	actin cytoskeleton organization
GO:0033206	meiotic cytokinesis
GO:0034314	Arp2/3 complex-mediated actin nucleation
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051321	meiotic cell cycle
GO:0051653	spindle localization
GO:0060271	cilium assembly
GO:0071346	cellular response to type II interferon
GO:1905168	positive regulation of double-strand break repair via homologous recombination
GO:2001032	regulation of double-strand break repair via nonhomologous end joining

	Cellular Component
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005885	Arp2/3 protein complex
GO:0005925	focal adhesion
GO:0005938	cell cortex
GO:0015629	actin cytoskeleton
GO:0016020	membrane
GO:0030478	actin cap
GO:0035578	azurophil granule lumen
GO:0035861	site of double-strand break
GO:0042995	cell projection
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6yw6, PDBe:6yw6, PDBj:6yw6
PDBsum	6yw6
PubMed	32661131
UniProt	P61160\|ARP2_HUMAN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]