Structure of PDB 6yav Chain B

Receptor sequence

>6yavB (length=119) Species: 354 (Azotobacter vinelandii)

ATIYFSSPLMPHNKKVQAVAGKRSTLLGVAQENGVKIPFECQDGNCGSCL
VKITHLDGERIKGMLLTDKERNVLKSVGKLPKSEEERAAVRDLPPTYRLA
CQTIVTDEDLLVEFTGEPG

3D structure

• PDB: 6yav Structure of FeSII (Shethna) protein from Azotobacter vinelandii
• Chain: B
• Resolution: 1.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	C42 G45 C47 G48 S49 C50 C102	C41 G44 C46 G47 S48 C49 C101

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0009399 nitrogen fixation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6yav, PDBe:6yav, PDBj:6yav
• PDBsum: 6yav
• UniProt: Q44501|FESII_AZOVI Protein FeSII (Gene Name=fesII)