Structure of PDB 6y2c Chain B |
>6y2cB (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMFREVRNEEGIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDG TTPERIAQITGPPDRCQHAAEIITDLLRSVQAGN |
|
PDB | 6y2c Comparative structural analyses and nucleotide-binding characterization of the four KH domains of FUBP1. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
S259 D304 H334 |
S1 D38 H68 |
|
|
|
|