Structure of PDB 6xl8 Chain B

Receptor sequence

>6xl8B (length=257) Species: 9606 (Homo sapiens)

SKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAW
YRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTR
AISDYTQTLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHW
LRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKG
FPCLKKAEGSSRPHCLGKTKGRTHPEIDREVVRRLREFYRPFNLKFYQMT
GHDFGWD

3D structure

• PDB: 6xl8 Deciphering the substrate recognition mechanisms of the heparan sulfate 3- O -sulfotransferase-3.
• Chain: B
• Resolution: 2.34 Å

Enzymatic activity

• Enzyme Commision number: 2.8.2.30: [heparan sulfate]-glucosamine 3-sulfotransferase 3.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNS	B	D252 T256 W283	D104 T108 W135
BS02	IDS	B	K161 Q255 K259	K13 Q107 K111
BS03	GNS	B	K161 E184 P217 S218	K13 E36 P69 S70
BS04	IDS	B	R166 E184 K215 Q255 K259 T367 K368 R370	R18 E36 K67 Q107 K111 T219 K220 R222
BS05	BDP	B	E170 H362	E22 H214
BS06	A3P	B	K162 G164 T165 R166 A167 R243 S251 F349 K368 G369 R370 H372	K14 G16 T17 R18 A19 R95 S103 F201 K220 G221 R222 H224

Gene Ontology

Molecular Function

• GO:0008146 sulfotransferase activity

External links

• PDB: RCSB:6xl8, PDBe:6xl8, PDBj:6xl8
• PDBsum: 6xl8
• PubMed: 34458837
• UniProt: Q9Y663|HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 (Gene Name=HS3ST3A1)