Structure of PDB 6x8z Chain B |
>6x8zB (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] |
NSAETYFESARVECAIQTCPELLRKDFESLFPKLMILTVTQKTKNDMTVW SEEVEIEREVLLEKFINGAKEICYALRAEGYWADFIDPSSGLAFFGPYTT DERYRHLGFSVDDLGCSKVIRHSLWGTHVVVGSIFTNATPDSHIMKKLSG |
|
PDB | 6x8z An Interprotein Co-S Coordination Complex in the B 12 -Trafficking Pathway. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
B12 |
B |
W189 L259 C261 |
W50 L114 C116 |
|
|
|
|