Structure of PDB 6x6e Chain B

Receptor sequence
>6x6eB (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNLE
3D structure
PDB6x6e Structural basis for glucocorticoid receptor recognition of both unmodified and methylated binding sites, precursors of a modern recognition element.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G439 S440 R447 R470 K471 R477 G21 S22 R29 R52 K53 R59
BS02 dna B C431 H432 Y433 K442 K446 C13 H14 Y15 K24 K28
BS03 ZN B C421 C424 C441 C3 C6 C23
BS04 ZN B C457 C463 C473 C476 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6x6e, PDBe:6x6e, PDBj:6x6e
PDBsum6x6e
PubMed34289059
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]