Structure of PDB 6x0j Chain B

Receptor sequence

>6x0jB (length=455) Species: 330879 (Aspergillus fumigatus Af293)

RLRSTPQDELHDLLCVGFGPASLAIAIALHDALDPRLNKSASNIHAQPKI
CFLERQKQFAWHSGMLVPGSKMQISFIKDLATLRDPRSSFTFLNYLHQKG
RLIHFTNLSTFLPARLEFEDYMRWCAQQFSDVVAYGEEVVEVIPGKSDPS
SSVVDFFTVRSRNVETGEISARRTRKVVIAIGGTAKMPSGLPQDPRIIHS
SKYCTTLPALLKDKSKPYNIAVLGSGQSAAEIFHDLQKRYPNSRTTLIMR
DSAMRPSDDSPFVNEIFNPERVDKFYSQSAAERQRSLLADKATNYSVVRL
ELIEEIYNDMYLQRVKNPDETQWQHRILPERKITRVEHHGPQSRMRIHLK
SSKPESNDVKETLEVDALMVATGYNRNAHERLLSKVQHLRPTGQDQWKPH
RDYRVEMDPSKVSSEAGIWLQGCNERTHGLSDSLLSVLAVRGGEMVQSIF
GEQLE

3D structure

• PDB: 6x0j Trapping conformational states of a flavin-dependent N -monooxygenase in crystallo reveals protein and flavin dynamics.
• Chain: B
• Resolution: 2.335 Å

Enzymatic activity

• Enzyme Commision number: 1.14.13.196: L-ornithine N(5)-monooxygenase [NAD(P)H].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	K100 Q102 R144 P217 S254 G255 Q256 S257 E260 R279 N323 Y324 S325 A404 T405 G406	K71 Q73 R115 P188 S225 G226 Q227 S228 E231 R250 N294 Y295 S296 A371 T372 G373
BS02	ORN	B	I103 K107 N293 F296 S469	I74 K78 N264 F267 S436
BS03	FDA	B	G46 G48 P49 A50 E83 R84 Q85 W90 H91 M101 Q102 I103 V168 I210 G211 Y407 S466 L467 L468	G17 G19 P20 A21 E54 R55 Q56 W61 H62 M72 Q73 I74 V139 I181 G182 Y374 S433 L434 L435

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004497 monooxygenase activity
• GO:0004499 N,N-dimethylaniline monooxygenase activity
• GO:0005506 iron ion binding
• GO:0031172 ornithine N5-monooxygenase activity
• GO:0070401 NADP+ binding

Biological Process

• GO:0006696 ergosterol biosynthetic process
• GO:0006879 intracellular iron ion homeostasis
• GO:0009058 biosynthetic process
• GO:0010106 cellular response to iron ion starvation
• GO:0019290 siderophore biosynthetic process
• GO:0031169 ferrichrome biosynthetic process
• GO:0033214 siderophore-dependent iron import into cell
• GO:0044550 secondary metabolite biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:6x0j, PDBe:6x0j, PDBj:6x0j
• PDBsum: 6x0j
• PubMed: 32723870
• UniProt: E9QYP0|SIDA_ASPFU L-ornithine N(5)-monooxygenase (Gene Name=sidA)