Structure of PDB 6x0c Chain B

Receptor sequence

>6x0cB (length=394) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

TTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKN
YAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRM
GKSEIIAETGAGAHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRL
MGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIV
REFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVG
LIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALES
SHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARG

3D structure

• PDB: 6x0c External aldimine form of Tryptophan Synthase mutant beta-Q114A in complex with Cesium ion at the metal coordination site and benzimidazole at the enzyme beta site.
• Chain: B
• Resolution: 1.45 Å

Enzymatic activity

• Enzyme Commision number: 4.2.1.20: tryptophan synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BZI	B	T3 L4 L5 N6	T2 L3 L4 N5
BS02	0JO	B	H86 K87 T110 A114 H115 T190 G232 G234 S235 N236 G303 E350 S377	H85 K86 T109 A113 H114 T189 G231 G233 S234 N235 G302 E349 S376
BS03	BZI	B	K87 E109 L166 G189 T190 G233 F306	K86 E108 L165 G188 T189 G232 F305

Gene Ontology

Molecular Function

• GO:0004834 tryptophan synthase activity
• GO:0005515 protein binding
• GO:0016829 lyase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0000162 tryptophan biosynthetic process
• GO:0006568 tryptophan metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6x0c, PDBe:6x0c, PDBj:6x0c
• PDBsum: 6x0c
• UniProt: P0A2K1|TRPB_SALTY Tryptophan synthase beta chain (Gene Name=trpB)