Structure of PDB 6wkp Chain B |
>6wkpB (length=117) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
NTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRKDLSP RWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAA IVLQLPQGTTLPKGFYA |
|
PDB | 6wkp Crystal structure of RNA-binding domain of nucleocapsid phosphoprotein from SARS CoV-2, monoclinic crystal form |
Chain | B |
Resolution | 2.67 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
D82 H145 |
D35 H89 |
|
|
|
|