Structure of PDB 6wj7 Chain B

Receptor sequence

>6wj7B (length=219) Species: 9606 (Homo sapiens)

VIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLR
EGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYL
GEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCK
GSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAE
ERQENLPDEIYHVYSFALR

3D structure

• PDB: 6wj7 Probing the Plasticity in the Active Site of Protein N-terminal Methyltransferase 1 Using Bisubstrate Analogues.
• Chain: B
• Resolution: 1.42 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.244: protein N-terminal methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	W20 M30 Y34 G69 G71 R74 D91 I92 T93 F96 G118 L119 W136 V137 H140 N168 D177 D180 E213 I214 Y215	W16 M26 Y30 G65 G67 R70 D87 I88 T89 F92 G114 L115 W132 V133 H136 N164 D173 D176 E209 I210 Y211

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008276 protein methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0071885 N-terminal protein N-methyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006480 N-terminal protein amino acid methylation
• GO:0007051 spindle organization
• GO:0007059 chromosome segregation
• GO:0018012 N-terminal peptidyl-alanine trimethylation
• GO:0018013 N-terminal peptidyl-glycine methylation
• GO:0018016 N-terminal peptidyl-proline dimethylation
• GO:0032259 methylation
• GO:0035572 N-terminal peptidyl-serine dimethylation
• GO:0035573 N-terminal peptidyl-serine trimethylation

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6wj7, PDBe:6wj7, PDBj:6wj7
• PDBsum: 6wj7
• PubMed: 32605369
• UniProt: Q9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 (Gene Name=NTMT1)