Structure of PDB 6w98 Chain B

Receptor sequence

>6w98B (length=77) Species: 83333 (Escherichia coli K-12)

STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEF
DTEIPDEEAEKITTVQAAIDYINGHQA

3D structure

• PDB: 6w98 Cryo-EM Structures and Regulation of Arabinofuranosyltransferase AftD from Mycobacteria.
• Chain: B
• Resolution: 2.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D35
• Catalytic site (residue number reindexed from 1): D35

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PNS	B	S36 L37	S36 L37

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0031177 phosphopantetheine binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process
• GO:0009410 response to xenobiotic stimulus

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6w98, PDBe:6w98, PDBj:6w98
• PDBsum: 6w98
• PubMed: 32386575
• UniProt: P0A6A8|ACP_ECOLI Acyl carrier protein (Gene Name=acpP)