Structure of PDB 6vly Chain B

Receptor sequence
>6vlyB (length=284) Species: 214856 (Alistipes finegoldii) [Search protein sequence]
YNLLKGKKGLIFGALNEQSIAWKVAERAVEEGAEIVLTNTAVSIRMGTIG
RLAEKCNTIVVPADATSVEDLENLIDKTMEHFGGKFDFMLHSIGMSPNVR
KGRTYDDLDYDYLSKTLDISAISFHKAIQVARKKDAINDWGSIVALSYIA
AQRTLYGYNDMADAKALLESIARSFGYIYGREKHVRINTVSQSPTPTTAG
SGVLGMGDLMNFAENMSPLGNASANDCADYVLTLFSDLTRKVTMQNLYHD
GGFASMGMSRRAMKTYEKGMRFEDVHQNQYPFGE
3D structure
PDB6vly The genome of a Bacteroidetes inhabitant of the human gut encodes a structurally distinct enoyl-acyl carrier protein reductase (FabI).
ChainB
Resolution1.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAI B G15 S21 I22 N41 T42 S45 D66 A67 S94 I95 L148 S149 Y150 K167 Q194 P196 T197 T199 A201 G13 S19 I20 N39 T40 S43 D64 A65 S92 I93 L146 S147 Y148 K165 Q192 P194 T195 T197 A199 MOAD: Kd=225nM
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 06:45:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6vly', asym_id = 'B', title = 'The genome of a Bacteroidetes inhabitant of the ...nct enoyl-acyl carrier protein reductase (FabI). '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6vly', asym_id='B', title='The genome of a Bacteroidetes inhabitant of the ...nct enoyl-acyl carrier protein reductase (FabI). ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '6vly', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='6vly', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>