Structure of PDB 6v64 Chain B

Receptor sequence

>6v64B (length=252) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTG
QPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS
GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
QF

3D structure

• PDB: 6v64 19F NMR reveals the conformational properties of free thrombin and its zymogen precursor prethrombin-2.
• Chain: B
• Resolution: 2.29 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E197 G198 D199 S200 G201
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E23 I24 G25 M26 P28 X29 D116 H119 P120 C122 Y134 K135 R137 N159 K202 R206 X207	E8 I9 G10 M11 P13 X14 D113 H116 P117 C119 Y134 K135 R137 N159 K207 R213 X214
BS02	0G6	B	H57 Y60A X60D L99 D189 A190 S195 S214 X215 G216	H43 Y47 X50 L96 D194 A195 S200 S221 X222 G223

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6v64, PDBe:6v64, PDBj:6v64
• PDBsum: 6v64
• PubMed: 32358061
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)