Structure of PDB 6uxe Chain B

Receptor sequence
>6uxeB (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
AASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVE
IQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENR
3D structure
PDB6uxe The essential function of ISCU2 and its conserved N-terminus in Fe/S cluster biogenesis
ChainB
Resolution1.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 EDT B K21 R29 E84 K20 R28 E83
BS02 8Q1 B R6 F40 N43 K44 V46 I52 R5 F39 N42 K43 V45 I51
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0016226 iron-sulfur cluster assembly
GO:0044571 [2Fe-2S] cluster assembly
GO:0044572 [4Fe-4S] cluster assembly
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0016604 nuclear body
GO:0099128 mitochondrial [2Fe-2S] assembly complex
GO:1990221 L-cysteine desulfurase complex
GO:1990229 iron-sulfur cluster assembly complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uxe, PDBe:6uxe, PDBj:6uxe
PDBsum6uxe
PubMed
UniProtQ9HD34|LYRM4_HUMAN LYR motif-containing protein 4 (Gene Name=LYRM4)

[Back to BioLiP]