Structure of PDB 6uio Chain B |
>6uioB (length=110) Species: 10090 (Mus musculus) [Search protein sequence] |
NYFGSINISNANVKQAVWFAMKEYNKESEDKYVFLVDKILHAKLQITDRM EYQIDVQISRSNCKKPLNNTENCIPQKKPELEKKMSCSFLVGALPWNGEF NLLSKECKDV |
|
PDB | 6uio Maturation of the functional mouse CRES amyloid from globular form. |
Chain | B |
Resolution | 1.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
I2I |
B |
N42 N44 |
N10 N12 |
|
|
|
|