Structure of PDB 6ty2 Chain B |
>6ty2B (length=53) Species: 31744 (Rice yellow mottle virus) [Search protein sequence] |
IDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKY LNF |
|
PDB | 6ty2 A Flexible and Original Architecture of Two Unrelated Zinc Fingers Underlies the Role of the Multitask P1 in RYMV Spread. |
Chain | B |
Resolution | 1.98 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H8 C39 H44 C48 |
H5 C36 H41 C45 |
|
|
|