Structure of PDB 6txv Chain B

Receptor sequence

>6txvB (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 6txv Tolcapone, a potent aggregation inhibitor for the treatment of familial leptomeningeal amyloidosis.
• Chain: B
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TCW	B	K15 L17 A108 L110 S117	K6 L8 A99 L101 S108	MOAD: Kd=3.1uM BindingDB: Kd=56nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6txv, PDBe:6txv, PDBj:6txv
• PDBsum: 6txv
• PubMed: 32324953
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)