Structure of PDB 6twu Chain B

Receptor sequence

>6twuB (length=421) Species: 9606 (Homo sapiens) [Search protein sequence]

FFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPA
ALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYP
LGSSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQR
QDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASM
KGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFR
KLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMT
ERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPL
YFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYY
IQQDTKGDYQKALLYLCGGDD

3D structure

PDB

6twu Dual Specificity PDZ- and 14-3-3-Binding Motifs: A Structural and Interactomics Study.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	B	G481 F482 G483 F484 T485 V486	G24 F25 G26 F27 T28 V29
BS02	CA	B	G589 V590 E592	G132 V133 E135
BS03	CA	B	G659 D701	G202 D244
BS04	CA	B	K745 E786	K288 E329
BS05	CA	B	M817 G819 G821 D861	M360 G362 G364 D404

Gene Ontology

	Molecular Function
GO:0001786	phosphatidylserine binding
GO:0002020	protease binding
GO:0003723	RNA binding
GO:0004859	phospholipase inhibitor activity
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005544	calcium-dependent phospholipid binding
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
GO:0008092	cytoskeletal protein binding
GO:0019834	phospholipase A2 inhibitor activity
GO:0042802	identical protein binding
GO:0044548	S100 protein binding
GO:0048306	calcium-dependent protein binding
GO:0098641	cadherin binding involved in cell-cell adhesion

	Biological Process
GO:0001525	angiogenesis
GO:0001765	membrane raft assembly
GO:0001921	positive regulation of receptor recycling
GO:0002091	negative regulation of receptor internalization
GO:0006900	vesicle budding from membrane
GO:0007155	cell adhesion
GO:0007160	cell-matrix adhesion
GO:0010756	positive regulation of plasminogen activation
GO:0014823	response to activity
GO:0030199	collagen fibril organization
GO:0030324	lung development
GO:0031340	positive regulation of vesicle fusion
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process
GO:0036035	osteoclast development
GO:0042730	fibrinolysis
GO:0042789	mRNA transcription by RNA polymerase II
GO:0044090	positive regulation of vacuole organization
GO:0045921	positive regulation of exocytosis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050767	regulation of neurogenesis
GO:0098609	cell-cell adhesion
GO:1904019	epithelial cell apoptotic process
GO:1905581	positive regulation of low-density lipoprotein particle clearance
GO:1905597	positive regulation of low-density lipoprotein particle receptor binding
GO:1905599	positive regulation of low-density lipoprotein receptor activity
GO:1905602	positive regulation of receptor-mediated endocytosis involved in cholesterol transport
GO:1905686	positive regulation of plasma membrane repair

	Cellular Component
GO:0001533	cornified envelope
GO:0005576	extracellular region
GO:0005604	basement membrane
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005769	early endosome
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005912	adherens junction
GO:0009986	cell surface
GO:0012506	vesicle membrane
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016363	nuclear matrix
GO:0030496	midbody
GO:0031902	late endosome membrane
GO:0031982	vesicle
GO:0035578	azurophil granule lumen
GO:0035749	myelin sheath adaxonal region
GO:0042383	sarcolemma
GO:0042470	melanosome
GO:0043220	Schmidt-Lanterman incisure
GO:0045121	membrane raft
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0090575	RNA polymerase II transcription regulator complex
GO:0098797	plasma membrane protein complex
GO:1990665	AnxA2-p11 complex
GO:1990667	PCSK9-AnxA2 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6twu, PDBe:6twu, PDBj:6twu
PDBsum	6twu
PubMed	32294469
UniProt	P07355\|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2); Q96QZ7\|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (Gene Name=MAGI1)

[Back to BioLiP]