Structure of PDB 6tqo Chain B

Receptor sequence
>6tqoB (length=134) Species: 562 (Escherichia coli) [Search protein sequence]
AARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLA
GVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVA
INEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPN
3D structure
PDB6tqo Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
ChainB
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B A4 R7 R72 L77 Y100 V102 N105 I108 E109 K112 E117 D118 K121 F122 N124 G125 V126 A1 R4 R69 L74 Y97 V99 N102 I105 E106 K109 E114 D115 K118 F119 N121 G122 V123
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tqo, PDBe:6tqo, PDBj:6tqo
PDBsum6tqo
PubMed32871103
UniProtP0A780|NUSB_ECOLI Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]