Structure of PDB 6tqn Chain B

Receptor sequence
>6tqnB (length=134) Species: 562 (Escherichia coli) [Search protein sequence]
AARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLA
GVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVA
INEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPN
3D structure
PDB6tqn Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
ChainB
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B A4 R7 Y69 S71 R72 L77 E81 K101 V102 I104 N105 I108 E109 K112 D118 S119 K121 F122 N124 G125 D128 A1 R4 Y66 S68 R69 L74 E78 K98 V99 I101 N102 I105 E106 K109 D115 S116 K118 F119 N121 G122 D125
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tqn, PDBe:6tqn, PDBj:6tqn
PDBsum6tqn
PubMed32871103
UniProtP0A780|NUSB_ECOLI Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]