Structure of PDB 6tm5 Chain B

Receptor sequence

>6tm5B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQ
CSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

3D structure

PDB

6tm5 A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C23 M28 H56	C23 M28 H56
BS02	ZN	B	C51 H53 C76	C51 H53 C76

Gene Ontology

	Molecular Function
GO:0004842	ubiquitin-protein transferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0034450	ubiquitin-ubiquitin ligase activity
GO:0046872	metal ion binding
GO:0061630	ubiquitin protein ligase activity
GO:0097602	cullin family protein binding

	Biological Process
GO:0000278	mitotic cell cycle
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007346	regulation of mitotic cell cycle
GO:0016567	protein ubiquitination
GO:0031145	anaphase-promoting complex-dependent catabolic process
GO:0045842	positive regulation of mitotic metaphase/anaphase transition
GO:0051301	cell division
GO:0051445	regulation of meiotic cell cycle
GO:0070936	protein K48-linked ubiquitination
GO:0070979	protein K11-linked ubiquitination
GO:0141198	protein branched polyubiquitination

External links

PDB	RCSB:6tm5, PDBe:6tm5, PDBj:6tm5
PDBsum	6tm5
PubMed	32307883
UniProt	Q9NYG5\|APC11_HUMAN Anaphase-promoting complex subunit 11 (Gene Name=ANAPC11)