Structure of PDB 6t9w Chain B

Receptor sequence

>6t9wB (length=383) Species: 682795 (Granulicella mallensis MP5ACTX8)

AKILCVLYDDPITGYPKSYARADVPKIDHYPGGQTAPTPKQIDFTPGELL
GSVSGELGLRKYLEGLGHTLVVTSDKEGEDSVFERELPDAEIVISQPFWP
AYLTPERIAKAKKLKLAVTAGIGSDHVDLEAAIKNGITVAEVTYSNSISV
SEHVVMMILSLVRNYIPSYQWVIKGGWNIADCVERSYDLEAMHVGTVAAG
RIGLAVLKRLKPFDVKLHYFARHRLPESVENELGLTYHPSVEDMVKVCDV
VTINAPLHPGTLDLFNDELISKMKRGAYLVNTARGKICNRDAVVRALESG
QLAGYAGDVWFPQPAPKDHPWRTMPHHGMTPHISGTSLSAQARYAAGTRE
ILECWFEERPIREEYLIVDGGKLAGTGAHSYTV

3D structure

• PDB: 6t9w From the Amelioration of a NADP+-dependent Formate Dehydrogenase to the Discovery of a New Enzyme: Round Trip from Theory to Practice
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Enzyme Commision number: 1.17.1.9: formate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	I123 N147 S148 V151 A199 G201 R202 I203 F221 R223 P257 H259 T262 T283 A284 R285 D309 H333 S335 G336 S381	I122 N146 S147 V150 A198 G200 R201 I202 F220 R222 P256 H258 T261 T282 A283 R284 D308 H332 S334 G335 S380
BS02	AZI	B	P98 F99 G122 I123 H333	P97 F98 G121 I122 H332

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008863 formate dehydrogenase (NAD+) activity
• GO:0016491 oxidoreductase activity
• GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0051287 NAD binding

Biological Process

• GO:0042183 formate catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6t9w, PDBe:6t9w, PDBj:6t9w
• PDBsum: 6t9w
• UniProt: G8NTI5