Structure of PDB 6t7b Chain B

Receptor sequence
>6t7bB (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]
HRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIR
DAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
3D structure
PDB6t7b Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function.
ChainB
Resolution5.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B I46 S47 G48 K79 I29 S30 G31 K62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0032200 telomere organization
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7b, PDBe:6t7b, PDBj:6t7b
PDBsum6t7b
PubMed32350470
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]