Structure of PDB 6t58 Chain B

Receptor sequence
>6t58B (length=311) Species: 9606 (Homo sapiens) [Search protein sequence]
AYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRR
TKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSL
IEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGR
RAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKV
FDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSM
KGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQ
KALLYLCGGDD
3D structure
PDB6t58 Structure Determination of the Transactivation Domain of p53 in Complex with S100A4 Using Annexin A2 as a Crystallization Chaperone.
ChainB
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B M504 G508 T509 D548 M250 G254 T255 D294
BS02 CA B M344 G346 L347 G348 D388 M90 G92 L93 G94 D134
BS03 CA B G428 V429 R431 G433 E473 G174 V175 R177 G179 E219
BS04 CA B G276 V277 E279 G22 V23 E25
BS05 CA B K314 L317 S318 E322 K60 L63 S64 E68
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0002020 protease binding
GO:0003723 RNA binding
GO:0003779 actin binding
GO:0004859 phospholipase inhibitor activity
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005544 calcium-dependent phospholipid binding
GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
GO:0008092 cytoskeletal protein binding
GO:0019834 phospholipase A2 inhibitor activity
GO:0042056 chemoattractant activity
GO:0042802 identical protein binding
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
GO:0098641 cadherin binding involved in cell-cell adhesion
Biological Process
GO:0001525 angiogenesis
GO:0001765 membrane raft assembly
GO:0001837 epithelial to mesenchymal transition
GO:0001921 positive regulation of receptor recycling
GO:0002091 negative regulation of receptor internalization
GO:0006900 vesicle budding from membrane
GO:0007155 cell adhesion
GO:0007160 cell-matrix adhesion
GO:0010756 positive regulation of plasminogen activation
GO:0014823 response to activity
GO:0030199 collagen fibril organization
GO:0030324 lung development
GO:0031340 positive regulation of vesicle fusion
GO:0032804 negative regulation of low-density lipoprotein particle receptor catabolic process
GO:0036035 osteoclast development
GO:0042730 fibrinolysis
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0044090 positive regulation of vacuole organization
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0050918 positive chemotaxis
GO:0098609 cell-cell adhesion
GO:1904019 epithelial cell apoptotic process
GO:1905581 positive regulation of low-density lipoprotein particle clearance
GO:1905597 positive regulation of low-density lipoprotein particle receptor binding
GO:1905599 positive regulation of low-density lipoprotein receptor activity
GO:1905602 positive regulation of receptor-mediated endocytosis involved in cholesterol transport
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0001533 cornified envelope
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005769 early endosome
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005912 adherens junction
GO:0009986 cell surface
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016363 nuclear matrix
GO:0030496 midbody
GO:0031902 late endosome membrane
GO:0031982 vesicle
GO:0035578 azurophil granule lumen
GO:0035749 myelin sheath adaxonal region
GO:0042383 sarcolemma
GO:0042470 melanosome
GO:0043220 Schmidt-Lanterman incisure
GO:0045121 membrane raft
GO:0048471 perinuclear region of cytoplasm
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex
GO:1990667 PCSK9-AnxA2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t58, PDBe:6t58, PDBj:6t58
PDBsum6t58
PubMed32442400
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53);
P07355|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2);
P26447|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)

[Back to BioLiP]