Structure of PDB 6swl Chain B |
>6swlB (length=130) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] |
MHEKTILVVDDEPRAREGMKRLLEKWASGKHRIITAANGQEALDILRQER VHVLLTDIRMPEITGLDVLEEMREKDDSPAVILISAYPDFDYAQKAISLG VLNYLLKPVKKSELFEAVEKAIHVSEQKER |
|
PDB | 6swl The REC domain of XynC, a response regulator from Geobacillus stearothermophilus |
Chain | B |
Resolution | 2.17 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D11 X57 R59 |
D11 X57 R59 |
|
|
|
|