Structure of PDB 6sva Chain B

Receptor sequence

>6svaB (length=146) Species: 9796 (Equus caballus)

VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSN
PGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDP
ENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH

3D structure

• PDB: 6sva Protein-to-structure pipeline for ambient-temperature crystallography at VMXi
• Chain: B
• Resolution: 1.92 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	T38 F41 F42 H63 S70 L88 H92 L96 N102 F103 L141	T38 F41 F42 H63 S70 L88 H92 L96 N102 F103 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:6sva, PDBe:6sva, PDBj:6sva
• PDBsum: 6sva
• UniProt: P02062|HBB_HORSE Hemoglobin subunit beta (Gene Name=HBB)