Structure of PDB 6sul Chain B

Receptor sequence

>6sulB (length=334) Species: 1408 (Bacillus pumilus)

MHKDVKAIYEESKILDEATHLYGVQRSDIHFIADAENYVYELKKDGESFI
LKITHTIRRSPDYILGEMEWLHHLAKGGLSVAKPIASLNGRDIEQVDDGQ
GGSFLLRVYEKAPGHKVEEADWNDELFYALGQYTGRMHKLTKSYQLSDPR
YKRQEWDEEEQLKLRKYVPADQTLVFEQADRLMEKLAKLPKNQDTYGLVH
ADLHHGNFHWDQGKITTFDFDDIGYNWFMNDISILLYNVLWYPVIPYEDK
AAFAGNFMKQFLKGYREENELGDEWLAYIPDFLRLRHVLIYGLLHQAFDL
ATIGDEEKAMLASFRSDIEQAAPITTFDFTKLSQ

3D structure

• PDB: 6sul A kinase bioscavenger provides antibiotic resistance by extremely tight substrate binding.
• Chain: B
• Resolution: 1.35 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.230: amicoumacin kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	N207 D219	N207 D219
BS02	UAM	B	E36 E159 Q161 D202 H204 H205 G206 D222 N238 W241 Y242 I290 L293	E36 E159 Q161 D202 H204 H205 G206 D222 N238 W241 Y242 I290 L293	MOAD: Kd=80nM
BS03	ANP	B	I32 E36 N37 V39 I50 K52 K111 A112 K116 H204 G206 N207 F218 D219	I32 E36 N37 V39 I50 K52 K111 A112 K116 H204 G206 N207 F218 D219

Gene Ontology

Molecular Function

• GO:0004413 homoserine kinase activity
• GO:0005524 ATP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009088 threonine biosynthetic process

External links

• PDB: RCSB:6sul, PDBe:6sul, PDBj:6sul
• PDBsum: 6sul
• PubMed: 32637600
• UniProt: A8FAR5