Structure of PDB 6su0 Chain B

Receptor sequence
>6su0B (length=89) Species: 305 (Ralstonia solanacearum) [Search protein sequence]
SVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVT
SWLVGSAIHIRVYASTGTTTTEWCWDGKGWYKGAYTSTN
3D structure
PDB6su0 Engineered assembly of a protein-cucurbituril biohybrid.
ChainB
Resolution1.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 QQ7 B X34 G35 Y37 X33 G34 Y36
BS02 MFU B R17 E28 A40 W76 W81 R16 E27 A39 W75 W80
BS03 MFU B I16 W31 W36 I15 W30 W35
BS04 QQ7 B X79 G80 Y82 X78 G79 Y81
BS05 MFU B R62 E73 A85 R61 E72 A84
External links