Structure of PDB 6sty Chain B

Receptor sequence
>6styB (length=190) Species: 9606 (Homo sapiens) [Search protein sequence]
GAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGP
NLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVR
QQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRW
YPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKI
3D structure
PDB6sty Human REXO2 controls short mitochondrial RNAs generated by mtRNA processing and decay machinery to prevent accumulation of double-stranded RNA.
ChainB
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.15.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B E49 M50 G52 L53 W96 H100 H101 N142 S143 E146 E20 M21 G23 L24 W67 H71 H72 N113 S114 E117
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0008296 3'-5'-DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006259 DNA metabolic process
GO:0009117 nucleotide metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005759 mitochondrial matrix
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sty, PDBe:6sty, PDBj:6sty
PDBsum6sty
PubMed32365187
UniProtQ9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]