Structure of PDB 6sk8 Chain B

Receptor sequence

>6sk8B (length=387) Species: 9606 (Homo sapiens)

PAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQ
GFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPP
GWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKL
RSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPR
KLIEVKFSHLSMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRY
LKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPST
IMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLM
ENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGL

3D structure

• PDB: 6sk8 High-resolution snapshots of human N-myristoyltransferase in action illuminate a mechanism promoting N-terminal Lys and Gly myristoylation.
• Chain: B
• Resolution: 1.87 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D183 F188 F190 N246 T282 Y296 H298 F311 H313 Y401 Y420 I469 G470 D471 G472 L474	D79 F84 F86 N142 T178 Y192 H194 F207 H209 Y295 Y314 I363 G364 D365 G366 L368
BS02	MYA	B	Y117 F119 W120 Y180 V181 I245 N246 L248 C249 V250 R255 S256 R258 A260 T268 F277 A279 Y281 T282 L287 Y479	Y13 F15 W16 Y76 V77 I141 N142 L144 C145 V146 R151 S152 R154 A156 T164 F173 A175 Y177 T178 L183 Y373

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6sk8, PDBe:6sk8, PDBj:6sk8
• PDBsum: 6sk8
• PubMed: 32111831
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)