Structure of PDB 6siv Chain B

Receptor sequence

>6sivB (length=136) Species: 333760 (Human papillomavirus 16) [Search protein sequence]

RPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDLCIVYRDG
NPYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLLIRCINCQ
KPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCSRSS

3D structure

PDB

6siv Deciphering the molecular and structural interaction between IRF3 and HPV16 E6

Chain

Resolution

1.752 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C1103 C1106 C1136 C1139	C96 C99 C129 C132
BS02	ZN	B	C1030 C1033 C1063 C1066	C23 C26 C56 C59

Gene Ontology

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0019049	virus-mediated perturbation of host defense response
GO:0030162	regulation of proteolysis
GO:0039502	symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548	symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648	symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653	symbiont-mediated suppression of host transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0052150	symbiont-mediated perturbation of host apoptosis
GO:0090630	activation of GTPase activity

	Cellular Component
GO:0030430	host cell cytoplasm
GO:0042025	host cell nucleus

External links