Structure of PDB 6s75 Chain B

Receptor sequence
>6s75B (length=267) Species: 9606 (Homo sapiens) [Search protein sequence]
KALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFD
LMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDL
SRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLGGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQ
SPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRP
DVTYVYDVAKRMHACTA
3D structure
PDB6s75 Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
ChainB
Resolution3.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D161 K163 A165 N166 D179 T199
Catalytic site (residue number reindexed from 1) D142 K144 A146 N147 D160 T166
Enzyme Commision number 2.7.11.34: NEK6-subfamily protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F9N B I40 A114 A116 D118 N166 F168 I21 A95 A97 D99 N147 F149
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
GO:0140677 molecular function activator activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007346 regulation of mitotic cell cycle
GO:0016310 phosphorylation
GO:0032206 positive regulation of telomere maintenance
GO:0035865 cellular response to potassium ion
GO:0051225 spindle assembly
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
Cellular Component
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005815 microtubule organizing center
GO:0005856 cytoskeleton
GO:0005874 microtubule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s75, PDBe:6s75, PDBj:6s75
PDBsum6s75
PubMed32242624
UniProtQ8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 (Gene Name=NEK7)

[Back to BioLiP]