Structure of PDB 6s48 Chain B

Receptor sequence

>6s48B (length=228) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]

KFIQNAAEIAKKAMDSVDPSLSEKFTIVIRFLTDNPDAASALKGKERSIV
GTEEYIIASATNFKKGRDPRTPLPPSTIPDEMVSVILNKYFEVPSEELEK
AEEWHRLSMGAENIVGDLLERYIAEVIEPHGWIWCSGSMVRAVDFIYCDS
ENVWQSLQVKNRDNTENSSSAAIRHGTPIKKWFRTFSKKRGDNWDKFPSL
EGKENLSEKGFKLYVEKYLSALRAIKAL

3D structure

PDB

6s48 Restriction endonucleases that cleave RNA/DNA heteroduplexes bind dsDNA in A-like conformation.

Chain

Resolution

1.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	K68 P78 T80 M112 N170 S171	K65 P75 T77 M109 N167 S168
BS02	dna	B	E115 N116 G119 Q161 K163 N164 R165 N167 T168	E112 N113 G116 Q158 K160 N161 R162 N164 T165
BS03	dna	B	E115 N116 G119 Q161 K163 N164 R165 N167 T168	E112 N113 G116 Q158 K160 N161 R162 N164 T165
BS04	dna	B	N170 S171	N167 S168
BS05	dna	B	K68 P78 T80 M112 N170	K65 P75 T77 M109 N167
BS06	CA	B	D147 Q161 V162	D144 Q158 V159

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6s48, PDBe:6s48, PDBj:6s48
PDBsum	6s48
PubMed	32459314
UniProt	Q8YYB7

[Back to BioLiP]