Structure of PDB 6rxq Chain B

Receptor sequence

>6rxqB (length=226) Species: 83333 (Escherichia coli K-12)

PKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVGTPEGFDRDPELV
QAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNCDNLHERA
GNTNVIHMHGELLKVRCSQSGQALDWTGDVTPEPLRPHVVWFGEMPLGMD
EIYMALSMADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGN
EFAEKYYGPASQVVPEFVEKLLKGLK

3D structure

• PDB: 6rxq Evolved, Selective Erasers of Distinct Lysine Acylations.
• Chain: B
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E73 E79 R83 G191	E35 E41 R45 G143
BS02	peptide	B	V188 F190 G191 E192 M193 Y201 H218 V219 Y220 P221	V140 F142 G143 E144 M145 Y153 H170 V171 Y172 P173
BS03	KMQ	B	G48 A49 G50 E54 F60 W67 Q129 H147 V188 F190 G214 T215 S216 N240 L241 P257 A258	G10 A11 G12 E16 F22 W29 Q91 H109 V140 F142 G166 T167 S168 N192 L193 P209 A210

Gene Ontology

Molecular Function

• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:6rxq, PDBe:6rxq, PDBj:6rxq
• PDBsum: 6rxq
• PubMed: 32187803
• UniProt: P75960|NPD_ECOLI NAD-dependent protein deacylase (Gene Name=cobB)