Structure of PDB 6rr4 Chain B

Receptor sequence

>6rr4B (length=298) Species: 573 (Klebsiella pneumoniae)

QVQSGILPEHCRAAIWIEANLKGDVNALREASKIFVDNVATFQAKFPDAK
LGAVVAFGNNVWRQLSGGEGADELKDFPVYGKGLAPSTQYDLLIHILSAR
HEVNFSVAQAALAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEE
TRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKDAN
EEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYC
ARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQALG

3D structure

• PDB: 6rr4 X-ray-induced photoreduction of heme metal centers rapidly induces active-site perturbations in a protein-independent manner.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	D137 V142 D143 G144 T145 E146 W176 R197 H215 V219 D220 R232 L246 F248 Q261 M265 M276	D135 V140 D141 G142 T143 E144 W174 R195 H213 V217 D218 R230 L244 F246 Q259 M263 M274

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6rr4, PDBe:6rr4, PDBj:6rr4
• PDBsum: 6rr4
• PubMed: 32723869
• UniProt: A0A0W8ATM9