Structure of PDB 6rp5 Chain B

Receptor sequence

>6rp5B (length=144) Species: 56733 (Eleginops maclovinus)

VEWTDQERATISSIFGSLDYDDIGPKALSRCLIVYPWTQRHFGSFGNLYN
AEAIIGNQKVAAHGIKVLHGLDRAVKNMDNIKEIYAELSILHSEKLHVDP
DNFKLLADCLTIVVAAKMGSGFNPGTQATFQKFLAVVVSALGKQ

3D structure

• PDB: 6rp5 The unique structural features of carbonmonoxy hemoglobin from the sub-Antarctic fish Eleginops maclovinus.
• Chain: B
• Resolution: 1.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	H41 F42 K59 H63 V67 L88 L91 H92 L96 V98 F103 L106 L141	H41 F42 K59 H63 V67 L88 L91 H92 L96 V98 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:6rp5, PDBe:6rp5, PDBj:6rp5
• PDBsum: 6rp5
• PubMed: 31831781
• UniProt: K7N5M6|HBB1_ELEMC Hemoglobin subunit beta-1 (Gene Name=hbb1)