Structure of PDB 6rm2 Chain B

Receptor sequence

>6rm2B (length=343) Species: 1076759 (Vibrio phage phiVC8)

MENVDLVIDLQFGSTGKGLIAGYLAEKNGYDTVINANMPNAGHTYINAEG
RKWMHKVLPNGIVSPNLKRVMLGAGSVFSINRLMEEIEMSKDLLHDKVAI
LIHPMATVLDEEAHKKAEVGIATSIGSTGQGSMAAMVEKLQRDPTNNTIV
ARDVAQYDGRIAQYVCTVEEWDMALMASERILAEGAQGFSLSLNQEFYPY
CTSRDCTPARFLADMGIPLPMLNKVIGTARCHPIRVGGTSGGHYPDQEEL
TWEQLGQVPELTTVTKKVRRVFSFSFIQMQKAMWTCQPDEVFLNFCNYLS
PMGWQDIVHQIEVAAQSRYCDAEVKYLGFGPTFNDVELREDVM

3D structure

• PDB: 6rm2 Deoxyguanylosuccinate synthase (DgsS) quaternary structure with ATP, IMP, Magnesium at 2.5 Angstrom resolution
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S14 K17 G42 H43 Q187
• Catalytic site (residue number reindexed from 1): S14 K17 G42 H43 Q187
• Enzyme Commision number: 6.3.4.25: 2-amino-2'-deoxyadenylo-succinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	S14 T15 G16 K17 G18 G42 H43 T44 T263 R269 N294 F295 N297 G330 P331	S14 T15 G16 K17 G18 G42 H43 T44 T263 R269 N294 F295 N297 G330 P331
BS02	MG	B	G42 T263	G42 T263
BS03	IMP	B	N40 S127 T128 L191 C201 T202 V236	N40 S127 T128 L191 C201 T202 V236

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004019 adenylosuccinate synthase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0044208 'de novo' AMP biosynthetic process
• GO:0046040 IMP metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6rm2, PDBe:6rm2, PDBj:6rm2
• PDBsum: 6rm2
• UniProt: G3FFN6|PURZ_BPVC8 N6-succino-2-amino-2'-deoxyadenylate synthase (Gene Name=purZ)