Structure of PDB 6rke Chain B

Receptor sequence

>6rkeB (length=268) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRG
RAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQL
GSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPY
KLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTS
KDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPG
NLTRALAGEHVGTIITAS

3D structure

PDB

6rke Molybdate pumping into the molybdenum storage protein via an ATP-powered piercing mechanism.

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ADP	B	G44 G45 Q46 S47 K189 D190 L194 Y195 A197 N198 P199 K200 D223 S224 I225	G42 G43 Q44 S45 K187 D188 L192 Y193 A195 N196 P197 K198 D221 S222 I223
BS02	8M0	B	G127 G128 A129 F146 P151 L176 F180	G125 G126 A127 F144 P149 L174 F178
BS03	MOO	B	A78 G79 R83 Y86 R168 T169	A76 G77 R81 Y84 R166 T167
BS04	PO4	B	G77 A78 G79 R83 T169	G75 A76 G77 R81 T167
BS05	LJB	B	P124 V126 S132 V134 P135	P122 V124 S130 V132 P133

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6rke, PDBe:6rke, PDBj:6rke
PDBsum	6rke
PubMed	31811022
UniProt	P84253\|MOSB_AZOVD Molybdenum storage protein subunit beta (Gene Name=mosB)

[Back to BioLiP]